{"product_id":"proteintech-85684-6-rr","title":"Proteintech, 85684-6-RR, SPINT2\/HAI-2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SPINT2\/HAI-2 (85684-6-RR) by Proteintech is a Recombinant antibody targeting SPINT2\/HAI-2 in WB, ELISA applications with reactivity to human samples\n85684-6-RR targets SPINT2\/HAI-2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, Caco-2 cells,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSerine peptidase inhibitor Kunitz type 2 (SPINT2) is a serine protease inhibitor Kunitz type 2, also known as hepatocyte growth factor (HGF) activator (HGFA) inhibitor type 2 (HAI-2). It displays inhibitory activity in membrane serine proteases, such as matriptase and hepsin, as well as secreted proteases such as HGFA and plasmin (PMID: 9771903, PMID: 15792801). SPINT2 is a tumor suppressor gene that inhibits proteases implicated in cancer progression, like HGFA, hepsin and matriptase (PMID: 30168196). SPINT2 regulates cell proliferation, migration and invasion via a reduction in HGFA, leading to apoptosis and necrosis of uterine leiomyosarcoma cells (PMID: 20664929). This target may exhibit a molecular weight of approximately 28-34 kDa due to glycosylation modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3130 Product name: Recombinant Human SPINT2\/HAI-2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 28-197 aa of NM_021102.3 Sequence: ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK Predict reactive species\nFull Name: serine peptidase inhibitor, Kunitz type, 2\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28-34 kDa\nGenBank Accession Number: NM_021102.3\nGene Symbol: SPINT2\nGene ID (NCBI): 10653\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O43291-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888826568873,"sku":"85684-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85684-6-rr","provider":"Iright","version":"1.0","type":"link"}