{"product_id":"proteintech-85690-5-rr","title":"Proteintech, 85690-5-RR, CYP17A1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CYP17A1 (85690-5-RR) by Proteintech is a Recombinant antibody targeting CYP17A1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n85690-5-RR targets CYP17A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, mouse testis tissue,  rat testis tissue\nPositive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytochrome P450 17A1 (CYP17A1) is a critical steroidogenic enzyme, essential for producing glucocorticoids and sex hormones (PMID: 33781841). The CYP17A1 gene is expressed in the adrenal cortex and the gonads but not in the placenta (PMID: 19403566). Although CYP17A1 has been shown to be a 50-kDa protein, the presence of a lower molecular mass(30 kDa) immunoreactive form in rat Leydig cells was previously shown and it is either a degradation product or a truncated form of the 50 kDa enzyme (PMID: 15761033). Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5) and CYP17A1 is an important target for inhibition in the treatment of prostate cancer (PMID: 27505042).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5899 Product name: Recombinant human CYP17A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-508 aa of BC062997 Sequence: HNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST Predict reactive species\nFull Name: cytochrome P450, family 17, subfamily A, polypeptide 1\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 50-57 kDa\nGenBank Accession Number: BC062997\nGene Symbol: CYP17A1\nGene ID (NCBI): 1586\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P05093\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888732393641,"sku":"85690-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85690-5-rr","provider":"Iright","version":"1.0","type":"link"}