Proteintech, 85702-4-RR, SIN1/MAPKAP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The SIN1/MAPKAP1 (85702-4-RR) by Proteintech is a Recombinant antibody targeting SIN1/MAPKAP1 in WB, ELISA applications with reactivity to human samples 85702-4-RR targets SIN1/MAPKAP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-251 cells, MCF-7 cells, HaCaT cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Mitogen-activated protein kinase 2-associated protein 1 (MAPKAP1) is also named as MIP1 and SIN1. SIN1/MAPKAP1 is a major partner of mTORC2, acting as a scaffold and responsible for the substrate specificity of the mTOR catalytic subunit (PMID: 37877351). Besides as a component of MTORC2, MAPKAP1 also functions as MEKK2 and Ras-interacting protein and involves in regulating MEKK2 activation and RAS signaling (PMID: 31773361). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7753 Product name: Recombinant human MAPKAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-324 aa of BC002326 Sequence: MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGSRAD Predict reactive species Full Name: mitogen-activated protein kinase associated protein 1 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC002326 Gene Symbol: MAPKAP1 Gene ID (NCBI): 79109 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BPZ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.