Proteintech, 85721-3-RR, ZCCHC3 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZCCHC3 (85721-3-RR) by Proteintech is a Recombinant antibody targeting ZCCHC3 in WB, IF/ICC, ELISA applications with reactivity to human samples 85721-3-RR targets ZCCHC3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30047 Product name: Recombinant human ZCCHC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of NM_033089 Sequence: MATGGGAEEERKRGRPQLLPPARPAARGEEADGGREKMGWAQVVKNLAEKKGEFREPRPPRREEESGGGGGSAGLGGPAGLAAPDLGDFPPAGRGDPKGRRRDPAGEAVDPRKKKGAAEAGRRKKAEAAAAAMATPARPGEAEDAAERPLQDEPAAAAGPGKGRFLVRICF Predict reactive species Full Name: zinc finger, CCHC domain containing 3 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 43-45 kDa GenBank Accession Number: NM_033089 Gene Symbol: ZCCHC3 Gene ID (NCBI): 85364 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NUD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.