{"product_id":"proteintech-85723-4-rr","title":"Proteintech, 85723-4-RR, CD164 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD164 (85723-4-RR) by Proteintech is a Recombinant antibody targeting CD164 in WB, IHC, IF\/ICC, ELISA applications with reactivity to mouse samples\n85723-4-RR targets CD164 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: RM-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSialomucins are a heterogeneous group of secreted or membrane-associated mucins that appear to play 2 key but opposing roles in vivo: first as cytoprotective or antiadhesive agents, and second as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor (PMID: 9680353)(PMID: 17077324). Sialomucin CD164 (MUC-24), also referred to multi-glycosylated core protein 24 (MGC24), is known to function as a receptor that regulates stem cell localization to the bone marrow. CD164 may play a key role in hematopoiesis by facilitating the adhesion of CD34+ cells to the stroma and by negatively regulating CD34+CD38(lo\/-) cell proliferation. Important role of CD164 in in prostate cancer metastasis, promoting myogenesis and regulating myoblast migration so far have been revealed (PMID: 9763543)(PMID: 16859559)(PMID: 17077324).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2645 Product name: Recombinant Mouse CD164 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-162 aa of NM_016898.2 Sequence: QPNITTLAPNVTEVPTTTTKVVPTTQMPTVLPETCASFNSCVSCVNATFTNNITCFWLHCQEANKTYCANEPLSNCSQVNRTDLCSVIPPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGTTNTTLTPTSQPERKSTFD Predict reactive species\nFull Name: CD164 antigen\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: NM_016898.2\nGene Symbol: Cd164\nGene ID (NCBI): 53599\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9R0L9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888718729385,"sku":"85723-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85723-4-rr","provider":"Iright","version":"1.0","type":"link"}