{"product_id":"proteintech-85727-1-rr","title":"Proteintech, 85727-1-RR, STIM2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe STIM2 (85727-1-RR) by Proteintech is a Recombinant antibody targeting STIM2 in WB, IHC, ELISA applications with reactivity to human samples\n85727-1-RR targets STIM2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, BxPC-3 cells,  HepG2 cells,  HEK-293 cells,  HeLa cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTIM2, also named as KIAA1482, functions as a highly sensitive Ca2+ sensor in the endoplasmic reticulum which activates both store-operated and store-independent Ca2+-influx. Regulates basal cytosolic and endoplasmic reticulum Ca2+ concentrations. Upon mild variations of the endoplasmic reticulum Ca2+ concentration, STIM2 translocates from the endoplasmic reticulum to the plasma membrane where it probably activates the Ca2+ release-activated Ca2+ (CRAC) channels ORAI1, ORAI2 and ORAI3. STIM2 may inhibit STIM1-mediated Ca2+ influx. STIM2 has 2 isoforms 105kd and 115kd with Differential levels of phosphorylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag15530 Product name: Recombinant human STIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 525-674 aa of BC146661 Sequence: EKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGGVDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHHPQHTPHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAEKQ Predict reactive species\nFull Name: stromal interaction molecule 2\nCalculated Molecular Weight: 754 aa, 85 kDa\nObserved Molecular Weight: 85-115 kDa\nGenBank Accession Number: BC146661\nGene Symbol: STIM2\nGene ID (NCBI): 57620\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9P246\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888827912361,"sku":"85727-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85727-1-rr","provider":"Iright","version":"1.0","type":"link"}