Proteintech, 85735-2-RR, RNF181 Recombinant monoclonal antibody

Size: 20ul / 100ul The RNF181 (85735-2-RR) by Proteintech is a Recombinant antibody targeting RNF181 in WB, IF/ICC, ELISA applications with reactivity to human samples 85735-2-RR targets RNF181 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, A549 cells, U2OS cells, HEK-293 cells, Jurkat cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RNF181, also named as HSPC238, is a 153 amino acid protein, which belongs to the RNF181 family. RNF181 is widely expressed, with highest levels in liver and heart and lowest levels in brain and skeletal muscle. RNF181 as a E3 ubiquitin-protein ligase, accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14233 Product name: Recombinant human RNF181 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC002803 Sequence: MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT Predict reactive species Full Name: ring finger protein 181 Calculated Molecular Weight: 153 aa, 18 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC002803 Gene Symbol: RNF181 Gene ID (NCBI): 51255 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9P0P0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.