Proteintech, 85745-3-RR, SMR3B Recombinant monoclonal antibody

Size: 20ul / 100ul The SMR3B (85745-3-RR) by Proteintech is a Recombinant antibody targeting SMR3B in WB, ELISA applications with reactivity to human samples 85745-3-RR targets SMR3B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva, human saliva tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SMR3B is an androgen-regulated secreted PRP-family peptide produced primarily in the submandibular and sublingual glands. Released into saliva, it contributes to lubrication, oral defense, and glandular homeostasis. Highly tissue-specific, SMR3B serves as a marker of salivary gland function and is altered in xerostomia, Sjögren's syndrome, and head-and-neck cancers, highlighting its relevance in secretory physiology and disease. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3081 Product name: Recombinant Human SMR3B protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-79 aa of NM_006685.4 Sequence: QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP Predict reactive species Full Name: submaxillary gland androgen regulated protein 3B Calculated Molecular Weight: 8 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: NM_006685.4 Gene Symbol: SMR3B Gene ID (NCBI): 10879 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02814 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.