Product Description
Size: 20ul / 100ul
The SMR3B (85745-3-RR) by Proteintech is a Recombinant antibody targeting SMR3B in WB, ELISA applications with reactivity to human samples
85745-3-RR targets SMR3B in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human saliva, human saliva tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
SMR3B is an androgen-regulated secreted PRP-family peptide produced primarily in the submandibular and sublingual glands. Released into saliva, it contributes to lubrication, oral defense, and glandular homeostasis. Highly tissue-specific, SMR3B serves as a marker of salivary gland function and is altered in xerostomia, Sjögren's syndrome, and head-and-neck cancers, highlighting its relevance in secretory physiology and disease.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg3081 Product name: Recombinant Human SMR3B protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-79 aa of NM_006685.4 Sequence: QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP Predict reactive species
Full Name: submaxillary gland androgen regulated protein 3B
Calculated Molecular Weight: 8 kDa
Observed Molecular Weight: 8 kDa
GenBank Accession Number: NM_006685.4
Gene Symbol: SMR3B
Gene ID (NCBI): 10879
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P02814
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924