{"product_id":"proteintech-85745-3-rr","title":"Proteintech, 85745-3-RR, SMR3B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SMR3B (85745-3-RR) by Proteintech is a Recombinant antibody targeting SMR3B in WB, ELISA applications with reactivity to human samples\n85745-3-RR targets SMR3B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva, human saliva tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMR3B is an androgen-regulated secreted PRP-family peptide produced primarily in the submandibular and sublingual glands. Released into saliva, it contributes to lubrication, oral defense, and glandular homeostasis. Highly tissue-specific, SMR3B serves as a marker of salivary gland function and is altered in xerostomia, Sjögren's syndrome, and head-and-neck cancers, highlighting its relevance in secretory physiology and disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3081 Product name: Recombinant Human SMR3B protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-79 aa of NM_006685.4 Sequence: QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP Predict reactive species\nFull Name: submaxillary gland androgen regulated protein 3B\nCalculated Molecular Weight: 8 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: NM_006685.4\nGene Symbol: SMR3B\nGene ID (NCBI): 10879\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02814\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888824471721,"sku":"85745-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85745-3-rr","provider":"Iright","version":"1.0","type":"link"}