{"product_id":"proteintech-85763-4-rr","title":"Proteintech, 85763-4-RR, DDX23 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DDX23 (85763-4-RR) by Proteintech is a Recombinant antibody targeting DDX23 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n85763-4-RR targets DDX23 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HeLa cells,  HEK-293T cells,  K-562 cells,  A549 cells,  NIH\/3T3 cells,  fetal human brain tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDEAD (Asp-Glu-Ala-Asp) box polypeptide 23 (DDX23, synonyms: prp28, MGC8416, U5-100K) is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX23 is a component of the U5 snRNP complex; it may facilitate conformational changes in the spliceosome during nuclear pre-mRNA splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0258 Product name: Recombinant human DDX23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 614-820 aa of BC002366 Sequence: ERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 23\nCalculated Molecular Weight: 96 kDa\nObserved Molecular Weight: 96-100 kDa\nGenBank Accession Number: BC002366\nGene Symbol: DDX23\nGene ID (NCBI): 9416\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BUQ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888734589097,"sku":"85763-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85763-4-rr","provider":"Iright","version":"1.0","type":"link"}