{"product_id":"proteintech-85779-1-rr","title":"Proteintech, 85779-1-RR, ADORA1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ADORA1 (85779-1-RR) by Proteintech is a Recombinant antibody targeting ADORA1 in WB, ELISA applications with reactivity to human samples\n85779-1-RR targets ADORA1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADORA1, also known as RDC7, is a receptor for adenosine. It is mediated by G proteins, which inhibit adenylyl cyclase. Adenosine is an important mediator of ethanol intoxication and exerts some of its effects via ADORA1 in the central nervous system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14092 Product name: Recombinant human ADORA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-243 aa of BC026340 Sequence: NFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLF Predict reactive species\nFull Name: adenosine A1 receptor\nCalculated Molecular Weight: 326 aa, 37 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC026340\nGene Symbol: Adenosine A1 Receptor\nGene ID (NCBI): 134\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P30542\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888689729705,"sku":"85779-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85779-1-rr","provider":"Iright","version":"1.0","type":"link"}