{"product_id":"proteintech-85790-4-rr","title":"Proteintech, 85790-4-RR, Ezrin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Ezrin (85790-4-RR) by Proteintech is a Recombinant antibody targeting Ezrin in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n85790-4-RR targets Ezrin in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Calu-3 cells,  A431 cells,  Jurkat cells,  MOLT-4 cells,  NIH\/3T3 cells,  C6 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse stomach tissue, Mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEzrin is a member of the ERM (Ezrin, Radixin, Moesin) protein family and serves as a crucial linker between the cell membrane and the actin cytoskeleton. It plays significant roles in various cellular processes, including maintaining cell morphology, facilitating cell movement and adhesion, regulating signal transduction, and influencing apoptosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag23530 Product name: Recombinant human Ezrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 477-529 aa of BC013903 Sequence: VYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQR Predict reactive species\nFull Name: ezrin\nCalculated Molecular Weight: 69 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC013903\nGene Symbol: Ezrin\nGene ID (NCBI): 7430\nENSEMBL Gene ID: ENSG00000092820\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P15311\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888613314729,"sku":"85790-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85790-4-rr","provider":"Iright","version":"1.0","type":"link"}