{"product_id":"proteintech-85800-9-rr","title":"Proteintech, 85800-9-RR, hCG Alpha Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe hCG Alpha (85800-9-RR) by Proteintech is a Recombinant antibody targeting hCG Alpha in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n85800-9-RR targets hCG Alpha in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Hydroxyurea treated JAR cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hydroxyurea treated JAR cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman chorionic gonadotropin (hCG) is a heterodimeric glycoprotein hormone consisting of two non-covalently linked subunits: a common α-subunit (hCGα) and a hormone-specific β-subunit (hCGβ). The α-subunit, also designated CGA (chorionic gonadotropin alpha chain), is a 92-amino-acid glycopeptide of ~14-22 kDa that is identical to the α-subunits of the pituitary glycoprotein hormones luteinizing hormone (LH), follicle-stimulating hormone (FSH), and thyroid-stimulating hormone (TSH). Because the α-subunit is shared among these hormones, its biological specificity is conferred by the unique β-subunit with which it associates.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3377 Product name: Recombinant Human hCG Alpha protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 25-116 aa of Sequence: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS Predict reactive species\nFull Name: CG beta\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 20 kDa\nGene Symbol: hCG Beta\nGene ID (NCBI): 1082\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P0DN86(CGB)+P01215(CGA)\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888428896425,"sku":"85800-9-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85800-9-rr","provider":"Iright","version":"1.0","type":"link"}