{"product_id":"proteintech-85813-5-rr","title":"Proteintech, 85813-5-RR, CD302 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD302 (85813-5-RR) by Proteintech is a Recombinant antibody targeting CD302 in WB, IHC, ELISA applications with reactivity to mouse, rat samples\n85813-5-RR targets CD302 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, mouse liver tissue\nPositive IHC detected in: mouse liver tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis. In mice and humans, CD302 is primarily expressed in the liver, lungs, lymph nodes (LNs), spleen, and bone marrow. In CD302 gene knockout (CD302KO) mice, the migration frequency and number of myeloid dendritic cells (mDC) in CD302KO lymph nodes were reduced compared to the wild type, confirming the functional role of CD302 in mDC migration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2660 Product name: Recombinant Mouse CD302 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-156 aa of NM_025422.4 Sequence: DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAANNH Predict reactive species\nFull Name: CD302 antigen\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: NM_025422.4\nGene Symbol: Cd302\nGene ID (NCBI): 66205\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9DCG2-2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888720728233,"sku":"85813-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85813-5-rr","provider":"Iright","version":"1.0","type":"link"}