{"product_id":"proteintech-85828-4-rr","title":"Proteintech, 85828-4-RR, Ctf1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Ctf1 (85828-4-RR) by Proteintech is a Recombinant antibody targeting Ctf1 in WB, ELISA applications with reactivity to mouse, rat samples\n85828-4-RR targets Ctf1 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue,  mouse lung tissue,  mouse uterus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTF1 (Cardiotrophin-1) is a member of the interleukin-6 (IL-6) family of cytokines. It is a secreted protein that induces cardiac myocyte hypertrophy in vitro and has been shown to bind and activate the IL-6ST\/gp130 receptor. CTF1 plays a crucial role in various physiological and pathological processes, including cardiac function, metabolism, and cancer progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2867 Product name: Recombinant Mouse Ctf1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 2-203 aa of NM_007795.1 Sequence: SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA Predict reactive species\nFull Name: cardiotrophin 1\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: NM_007795.1\nGene Symbol: Ctf1\nGene ID (NCBI): 13019\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q60753\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888730493097,"sku":"85828-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85828-4-rr","provider":"Iright","version":"1.0","type":"link"}