{"product_id":"proteintech-85841-5-rr","title":"Proteintech, 85841-5-RR, Cathepsin B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Cathepsin B (85841-5-RR) by Proteintech is a Recombinant antibody targeting Cathepsin B in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to mouse samples\n85841-5-RR targets Cathepsin B in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: J774A.1 cells, mouse brain tissue,  RAW 264.7 cells,  mouse liver tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: RAW 264.7 cells\nPositive FC (Intra) detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTSB(Cathepsin B) is also named as CPSB and belongs to the peptidase C1 family. It participates in intracellular degradation and turnover of proteins. Cathepsin B precursors found in human malignant ascites fluid do not possess mannose-rich carbohydrates suggesting that a defect in the post translational processing of carbohydrate moieties on tumor. Cathepsin B exists as both glycosylated and unglycosylated forms(PMID:1637335). In rat macrophages and hepatocytes pro- cathepsin B is 39 kDa (unglycosylated =35 kDa), whereas in human fibroblasts procathepsin B is 44.5-46kDa (unglycosylated=39kDa)(PMID:2097084). It can be detected the 39 kDa form of pro-CTSB,  31 kDa mature forms in mouse brain by western blot.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3028 Product name: Recombinant Mouse Ctsb protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 18-339 aa of NM_007798.3 Sequence: HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF Predict reactive species\nFull Name: cathepsin B\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 31 kDa, 39 kDa\nGenBank Accession Number: NM_007798.3\nGene Symbol: Ctsb\nGene ID (NCBI): 13030\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10605\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888716763305,"sku":"85841-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85841-5-rr","provider":"Iright","version":"1.0","type":"link"}