{"product_id":"proteintech-85900-1-rr","title":"Proteintech, 85900-1-RR, LAYN Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe LAYN (85900-1-RR) by Proteintech is a Recombinant antibody targeting LAYN in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n85900-1-RR targets LAYN in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, HeLa cells,  A549 cells,  NCI-H1299 cells,  A172 cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLAYN acts as a receptor for hyaluronic acid (HA) and is involved in various cellular processes, including cell adhesion, movement, and signal transduction. In the context of cancer, LAYN has been identified as a prognostic biomarker. High expression of LAYN is associated with poor prognosis and increased immune cell infiltration in various cancers, such as colorectal cancer and gastric cancer. It may also play a role in T-cell exhaustion and the regulation of tumor-associated macrophages (PMID: 30761122).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14508 Product name: Recombinant human LAYN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 246-374 aa of BC025407 Sequence: CWVWICRKRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFMTLVSVESGFVTNDIYEFSPDQMGRSKESGWVENEIYGY Predict reactive species\nFull Name: layilin\nCalculated Molecular Weight: 382 aa, 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC025407\nGene Symbol: LAYN\nGene ID (NCBI): 143903\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6UX15\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888433483945,"sku":"85900-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85900-1-rr","provider":"Iright","version":"1.0","type":"link"}