Proteintech, 85908-5-RR, Serpin A12/Vaspin Recombinant monoclonal antibody

Size: 20ul / 100ul The Serpin A12/Vaspin (85908-5-RR) by Proteintech is a Recombinant antibody targeting Serpin A12/Vaspin in WB, ELISA applications with reactivity to human samples 85908-5-RR targets Serpin A12/Vaspin in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human adipose tissue Recommended dilution Western Blot (WB): WB : 1:200-1:500 Background Information SERPINA12 is also named as Serpin A12 and Visceral adipose tissue-derived serine protease inhibitor (Vaspin). Vaspin is an adipokine belonging to the serpin family, thus also named SERPINA12, with targets in kallikrein 7 and 14 that participates in skin desquamation (PMID: 34359881). Vaspin is a compensatory molecule in obesity and insulin resistance (PMID: 18321232). Vaspin is a newly described adipokine with an insulin sensitizing effect and inhibitory impact on food intake (PMID: 16030142, PMID: 21465327). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2842 Product name: recombinant human SERPINA12 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-414 aa of NM_001304461.1 Sequence: LLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK Predict reactive species Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 47-50 kDa GenBank Accession Number: NM_001304461.1 Gene Symbol: Vaspin Gene ID (NCBI): 145264 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IW75 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.