Proteintech, 85938-2-RR, Spartin/SPG20 Recombinant monoclonal antibody

Size: 20ul / 100ul The Spartin/SPG20 (85938-2-RR) by Proteintech is a Recombinant antibody targeting Spartin/SPG20 in WB, IF/ICC, ELISA applications with reactivity to human samples 85938-2-RR targets Spartin/SPG20 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, PANC-1 cells, HL-60 cells, MDA-MB-231 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SPG20 (spastic paraplegia 20) gene encodes a multifunctional Spartin protein. SPG20 protein is highly expressed in adipose tissue and may be implicated in endosomal trafficking and microtubule dynamics. SPG20 is mutated in Troyer syndrome, a hereditary spastic paraplegia defined by degeneration of upper motor neurons, recent study showed that regulation of SPG20 on mitochondrial calcium homeostasis may contribute to the pathophysiology of Troyer syndrome. Hypermethylation of SPG20 promoter, found in colorectal cancer patients, may play a role in cytokinesis arrest in colorectal tumorigenesis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4815 Product name: Recombinant human Spartin, SPG20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC047083 Sequence: MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGTGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAEVNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQI Predict reactive species Full Name: spastic paraplegia 20 (Troyer syndrome) Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 75-84 kDa GenBank Accession Number: BC047083 Gene Symbol: Spartin Gene ID (NCBI): 23111 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N0X7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.