{"product_id":"proteintech-85950-1-rr","title":"Proteintech, 85950-1-RR, CD58 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD58 (85950-1-RR) by Proteintech is a Recombinant antibody targeting CD58 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n85950-1-RR targets CD58 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, LNCaP cells,  Ramos cells,  Jurkat cells,  K-562 cells,  Karpas-299 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD58, also known as lymphocyte function-associated antigen 3 (LFA-3), is a heavily glycosylated protein of 55-70 kDa that is expressed on a broad range of hematopoietic and non-hematopoietic cells. CD58 is involved in immune recognition of tumor cells via binding of the CD2 receptor expressed on cytotoxic T cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4236 Product name: Recombinant Human CD58 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 29-215 aa of BC005930 Sequence: FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR Predict reactive species\nFull Name: CD58 molecule\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 55-70 kDa\nGenBank Accession Number: BC005930\nGene Symbol: CD58\nGene ID (NCBI): 965\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P19256\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888602992809,"sku":"85950-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85950-1-rr","provider":"Iright","version":"1.0","type":"link"}