{"product_id":"proteintech-85961-1-rr","title":"Proteintech, 85961-1-RR, IL-17RB Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IL-17RB (85961-1-RR) by Proteintech is a Recombinant antibody targeting IL-17RB in WB, ELISA applications with reactivity to mouse, rat samples\n85961-1-RR targets IL-17RB in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, Transfected HEK-293T cells,  mouse liver tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-17RB is a transmembrane protein that belongs to the IL-17 receptor family. IL-17RB has a SEFIR cytoplasmic domain implicated in homotypic dimerization and recruitment of signaling proteins (shared with IL-17RA) and a TRAF6-binding domain (not found in IL-17RA). IL-17RB is expressed in various endocrine tissues and epithelial cells in different organs such as kidney, liver, and mucosal tissues. The IL-17B\/IL-17RB pathway is considered as a signaling cascade that promotes cancer cell survival, proliferation and migration. The pro-tumor functions associated with the IL 17B\/IL-17RB pathway are diverse and complex because they involve mechanisms that act directly on tumor cells, and also indirect mechanisms that lead to tumor microenvironment remodeling.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2798 Product name: recombinant mouse Il17rb protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 18-286 aa of NM_019583.3 Sequence: REPTIQCGSETGPSPEWMVQHTLTPGDLRDLQVELVKTSVAAEEFSILMNISWILRADASIRLLKATKICVSGKNNMNSYSCVRCNYTEAFQSQTRPSGGKWTFSYVGFPVELSTLYLISAHNIPNANMNEDSPSLSVNFTSPGCLNHVMKYKKQCTEAGSLWDPDITACKKNEKMVEVNFTTNPLGNRYTILIQRDTTLGFSRVLENKLMRTSVAIPVTEESEGAVVQLTPYLHTCGNDCIRREGTVVLCSETSAPIPPDDNRRMLGG Predict reactive species\nFull Name: interleukin 17 receptor B\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: NM_019583.3\nGene Symbol: Il17rb\nGene ID (NCBI): 50905\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9JIP3-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888768438441,"sku":"85961-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85961-1-rr","provider":"Iright","version":"1.0","type":"link"}