{"product_id":"proteintech-85973-3-rr","title":"Proteintech, 85973-3-RR, NMDAR1\/GRIN1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NMDAR1\/GRIN1 (85973-3-RR) by Proteintech is a Recombinant antibody targeting NMDAR1\/GRIN1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n85973-3-RR targets NMDAR1\/GRIN1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRIN1 encodes subunit 1 of the N-methyl-D-aspartate (NMDA) receptor, which is a heteromeric glutamate-gated calcium ion channel essential for synaptic function in the brain (PMID: 25864721, PMID: 25864721). NMDARs play important roles in normal brain development and function, such as synaptic plasticity, neural development, learning and memory (PMID: 20716669). NMDAR dysfunction has been associated with several neurological disorders including Parkinson, Alzheimer and Huntington diseases. Disrupted motor learning and long-term synaptic plasticity in mice lacking NMDAR1 in the striatum (PMID: 17015831).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26093 Product name: Recombinant human NMDAR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-120 aa of NM_000832 Sequence: MACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG Predict reactive species\nFull Name: glutamate receptor, ionotropic, N-methyl D-aspartate 1\nCalculated Molecular Weight: 105 kDa\nObserved Molecular Weight: 116-120 kDa\nGenBank Accession Number: NM_000832\nGene Symbol: NMDAR1\nGene ID (NCBI): 2902\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q05586\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888790884521,"sku":"85973-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85973-3-rr","provider":"Iright","version":"1.0","type":"link"}