{"product_id":"proteintech-85979-3-rr","title":"Proteintech, 85979-3-RR, AK1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe AK1 (85979-3-RR) by Proteintech is a Recombinant antibody targeting AK1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n85979-3-RR targets AK1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, HeLa cells,  K-562 cells,  A172 cells,  rat heart tissue,  human heart tissue\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAK1(Adenylate kinase isoenzyme 1), also known as ATP-AMP transphosphorylase 1. It is located in cytoplasm. This protein is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP 1. Exhibits nucleoside diphosphate kinase activity, catalyzing the production of ATP, CTP, GTP, UTP, dATP, dCTP, dGTP and dTTP from the corresponding diphosphate substrates with either ATP or GTP as phosphate donor 2. Also catalyzes at a very low rate the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP. The molecular weight of AK1 is 22 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6890 Product name: Recombinant human AK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC001116 Sequence: MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK Predict reactive species\nFull Name: adenylate kinase 1\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC001116\nGene Symbol: AK1\nGene ID (NCBI): 203\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P00568\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888690974889,"sku":"85979-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85979-3-rr","provider":"Iright","version":"1.0","type":"link"}