{"product_id":"proteintech-85990-2-rr","title":"Proteintech, 85990-2-RR, BRD2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BRD2 (85990-2-RR) by Proteintech is a Recombinant antibody targeting BRD2 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n85990-2-RR targets BRD2 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  A549 cells,  K-562 cells,  C2C12 cells,  PC-12 cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBRD2 (Bromodomain-containing protein 2), also known as RING3, is a member of the Bromodomain and Extra-Terminal (BET) family of proteins. These proteins contain two bromodomains and one extra-terminal domain. BRD2 primarily localizes to the nucleus and functions as an atypical protein kinase. Its main role involves the activation of E2F1 and E2F2 proteins, facilitating the production of proteins essential for the G1\/S phase transition of the cell cycle. BRD2 specifically recognizes acetylated histones through its bromodomains, particularly acetylated lysine residues on histones H3 and H4. This interaction allows BRD2 to recruit various transcription factors, co-activators, and repressors, thereby modulating transcriptional activity. BRD2 plays a crucial role in chromatin remodeling by recruiting proteins such as histone deacetylases. It is highly expressed during neural tube development and closure, making it essential for neurogenesis and embryogenesis.(PMID: 33462181, PMID: 37926722)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag17589 Product name: Recombinant human BRD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 537-668 aa of BC063840 Sequence: LSQGPISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRLPKKATKTAPPALPTGYDS Predict reactive species\nFull Name: bromodomain containing 2\nCalculated Molecular Weight: 836 aa, 92 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC063840\nGene Symbol: BRD2\nGene ID (NCBI): 6046\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P25440\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888712110249,"sku":"85990-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85990-2-rr","provider":"Iright","version":"1.0","type":"link"}