{"product_id":"proteintech-85995-1-rr","title":"Proteintech, 85995-1-RR, ARF3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ARF3 (85995-1-RR) by Proteintech is a Recombinant antibody targeting ARF3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n85995-1-RR targets ARF3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HepG2 cells,  mouse brain tissue,  rat brain tissue,  fetal human brain tissue,  mouse cerebellum tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20kda protein size. ARFs bind and regulate GTP\/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. ARF3 is 95% homolouous to ARF1. Its function was not fully understood. (PMID: 7759471, PMID: 16042562). This antibody can bind ARFs for the close sequences.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1174 Product name: Recombinant human ARF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC017565 Sequence: MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK Predict reactive species\nFull Name: ADP-ribosylation factor 3\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC017565\nGene Symbol: ARF3\nGene ID (NCBI): 377\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P61204\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888708014249,"sku":"85995-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-85995-1-rr","provider":"Iright","version":"1.0","type":"link"}