Proteintech, 85999-1-RR, Properdin/PFC Recombinant monoclonal antibody

Size: 20ul / 100ul The Properdin/PFC (85999-1-RR) by Proteintech is a Recombinant antibody targeting Properdin/PFC in WB, ELISA applications with reactivity to human, mouse, rat samples 85999-1-RR targets Properdin/PFC in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat plasma, human plasma, mouse serum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information CFP, also named as Properdin or PFC, is a 469 amino acid protein, which contains 7 TSP type-1 domains. CFP as secreted protein is a positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes. Properdin deficiency poses a significant risk for severe meningococcal infections (PMID: 22229731). Properdin may be novel biomarker for future risk of type 2 diabetes (PMID: 22338105). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2219 Product name: Recombinant Human CFP protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*His Domain: 28-469 aa of BC015756 Sequence: DPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL Predict reactive species Full Name: complement factor properdin Calculated Molecular Weight: 469 aa, 51 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC015756 Gene Symbol: CFP Gene ID (NCBI): 5199 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P27918 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.