{"product_id":"proteintech-86008-1-rr","title":"Proteintech, 86008-1-RR, SESN1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SESN1 (86008-1-RR) by Proteintech is a Recombinant antibody targeting SESN1 in WB, ELISA applications with reactivity to human samples\n86008-1-RR targets SESN1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, K-562 cells,  human skeletal muscle tissue,  human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:3000-1:30000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 1 is implicated in the inhibition of cell growth. It is approximately a 66kDa protein in humans (551 amino acids).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag16462 Product name: Recombinant human SESN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC112036 Sequence: MAEGENEVRWDGLCSRDSTTRETALENIRQTILRKTEYLRSVKETPHRPSDGLSNTESSDGLNKLLAHLLMLSKRCPFKDVREKSEFILKSIQELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHALFADSFAALGRLD Predict reactive species\nFull Name: sestrin 1\nCalculated Molecular Weight: 551 aa, 64 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC112036\nGene Symbol: SESN1\nGene ID (NCBI): 27244\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y6P5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888820900009,"sku":"86008-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86008-1-rr","provider":"Iright","version":"1.0","type":"link"}