Proteintech, 86013-3-RR, Testin Recombinant monoclonal antibody

Size: 20ul / 100ul The Testin (86013-3-RR) by Proteintech is a Recombinant antibody targeting Testin in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 86013-3-RR targets Testin in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, K-562 cells, mouse testis tissue, rat testis tissue, human testis tissue Positive IP detected in: K-562 cells Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Testin (TES) is a cytoskeleton-associated protein that localizes along actin stress fibers at cell-cell contact areas and at focal adhesion plaques. It interacts with a variety of cytoskeletal proteins and gets involved in regulation of cell adhesion and migration. TES is a putative tumor suppressor and reduced expression of TES has been reported in various cancers. In addition, TES is a marker for Sertoli-Germ Cell junction and is useful to monitor the disruption of intercellular junctions in the testis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0379 Product name: Recombinant human TES protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-323 aa of BC001451 Sequence: TVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHL Predict reactive species Full Name: testis derived transcript (3 LIM domains) Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 42-48 kDa GenBank Accession Number: BC001451 Gene Symbol: TES Gene ID (NCBI): 26136 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UGI8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.