{"product_id":"proteintech-86053-1-rr","title":"Proteintech, 86053-1-RR, CD3 epsilon Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD3 epsilon (86053-1-RR) by Proteintech is a Recombinant antibody targeting CD3 epsilon in WB, IHC, IF-P, ELISA applications with reactivity to mouse, rat samples\n86053-1-RR targets CD3 epsilon in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat thymus tissue, CTLL-2 cells,  mouse thymus tissue,  rat spleen tissue\nPositive IHC detected in: rat spleen tissue, rat thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat thymus tissue, rat spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD3 is a multimeric protein associated with the T-cell receptor (TCR) to form a complex involved in antigen recognition and signal transduction (PMID: 15885124). CD3 is composed of CD3γ, δ, ε, and ζ chains (PMID: 1826255). It is expressed by thymocytes in a developmentally regulated manner, T cells, and some NK cells (PMID: 3289580). The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction (PMID: 11985657). This antibody was raised against the epsilon chain of rat CD3 molecule.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1450 Product name: Recombinant Rat CD3 epsilon protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-103 aa of NP_001101610.2 Sequence: IEDTVTDDGAQKQYEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLY Predict reactive species\nFull Name: CD3 molecule, epsilon polypeptide\nCalculated Molecular Weight: 22kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: NP_001101610.2\nGene Symbol: Cd3e\nGene ID (NCBI): 315609\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: A6J423\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888720433321,"sku":"86053-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86053-1-rr","provider":"Iright","version":"1.0","type":"link"}