Proteintech, 86064-1-RR, WIBG Recombinant monoclonal antibody

Size: 20ul / 100ul The WIBG (86064-1-RR) by Proteintech is a Recombinant antibody targeting WIBG in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 86064-1-RR targets WIBG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, SH-SY5Y cells, HepG2 cells, U-251 cells, HL-60 cells, mouse thymus tissue, mouse spleen tissue Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Protein WIBG homolog, also known as PYM1 (Partner of Y14 and mago), is a cytoplasmic RNA-binding protein, that can interact with the ribosome and EJC, may act as an EJC destabilizing factor, preventing EJC accumulation at positions away from exon-exon junctions (non-canonical position). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6276 Product name: Recombinant human WIBG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-204 aa of BC006135 Sequence: MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL Predict reactive species Full Name: within bgcn homolog (Drosophila) Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23-27 kDa GenBank Accession Number: BC006135 Gene Symbol: WIBG Gene ID (NCBI): 84305 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BRP8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.