{"product_id":"proteintech-86064-1-rr","title":"Proteintech, 86064-1-RR, WIBG Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe WIBG (86064-1-RR) by Proteintech is a Recombinant antibody targeting WIBG in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n86064-1-RR targets WIBG in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, MCF-7 cells,  SH-SY5Y cells,  HepG2 cells,  U-251 cells,  HL-60 cells,  mouse thymus tissue,  mouse spleen tissue\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein WIBG homolog, also known as PYM1 (Partner of Y14 and mago), is a cytoplasmic RNA-binding protein,  that can interact with the ribosome and EJC, may act as an EJC destabilizing factor, preventing EJC accumulation at positions away from exon-exon junctions (non-canonical position).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6276 Product name: Recombinant human WIBG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-204 aa of BC006135 Sequence: MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL Predict reactive species\nFull Name: within bgcn homolog (Drosophila)\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23-27 kDa\nGenBank Accession Number: BC006135\nGene Symbol: WIBG\nGene ID (NCBI): 84305\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BRP8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888842559657,"sku":"86064-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86064-1-rr","provider":"Iright","version":"1.0","type":"link"}