Proteintech, 86080-1-RR, PLN Recombinant monoclonal antibody

Size: 20ul / 100ul The PLN (86080-1-RR) by Proteintech is a Recombinant antibody targeting PLN in WB, ELISA applications with reactivity to human, mouse, rat samples 86080-1-RR targets PLN in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue, human heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Phospholamban (PLN) is a 52-amino-acid transmembrane protein found in the sarcoplasmic reticulum (SR) of cardiac muscle cells. It has been postulated to regulate the activity of the calcium pump of cardiac sarcoplasmic reticulum. Phospholamban has a homopentamer form(25-27 kDa). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8632 Product name: Recombinant human PLN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC005269 Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL Predict reactive species Full Name: phospholamban Calculated Molecular Weight: 52 aa, 6 kDa Observed Molecular Weight: 10 kDa, 25 kDa GenBank Accession Number: BC005269 Gene Symbol: PLN Gene ID (NCBI): 5350 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26678 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.