{"product_id":"proteintech-86095-1-rr","title":"Proteintech, 86095-1-RR, TRMU Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TRMU (86095-1-RR) by Proteintech is a Recombinant antibody targeting TRMU in WB, ELISA applications with reactivity to human, mouse, rat samples\n86095-1-RR targets TRMU in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  A549 cells,  MCF-7 cells,  U2OS cells,  NIH\/3T3 cells,  rat heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRMU (tRNA m5C methyltransferase) is a mitochondrial protein involved in the modification of mitochondrial tRNA. Specifically, it catalyzes the formation of 5-methylcytidine at position 34 (m5C34) in the anticodon stem-loop of mitochondrial tRNAs, which is crucial for maintaining the stability and function of these tRNAs. TRMU is a nuclear-encoded protein located in the mitochondrial matrix. It plays a vital role in mitochondrial translation and oxidative phosphorylation.TRMU is associated with several genetic disorders. Mutations in the TRMU gene can cause mitochondrial diseases, such as infantile hepatic failure syndrome. (PMID:23625533)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag21930 Product name: Recombinant human TRMU protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-267 aa of BC027991 Sequence: MKKSLSRSTLRSPKGFSEIGLKLEMVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL Predict reactive species\nFull Name: tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase\nCalculated Molecular Weight: 421 aa, 48 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC027991\nGene Symbol: TRNT1\nGene ID (NCBI): 55687\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O75648\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888836989097,"sku":"86095-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86095-1-rr","provider":"Iright","version":"1.0","type":"link"}