Proteintech, 86106-1-RR, SHH Recombinant monoclonal antibody

Size: 20ul / 100ul The SHH (86106-1-RR) by Proteintech is a Recombinant antibody targeting SHH in WB, ELISA applications with reactivity to human, mouse, rat samples 86106-1-RR targets SHH in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SHH, also named as HHG-1, belongs to the hedgehog family. SHH binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. In the absence of SHH, PTC represses the constitutive signaling activity of SMO. It regulates another target, the gli oncogene. The Shh protein is synthesized as a 45-kDa precursor that undergoes an autocatalytic processing event that produces a 19-kDa N-terminal product, responsible for all signaling activities, and a 25-kDa C-terminal fragment (PMID:10753901, PMID: 16282375). SHH can be detected precursor protein as 48-51-kDa polypeptides (PMID: 15292211). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4010 Product name: recombinant human SHH protein Source: mammalian cells -derived, pHZ-KIsec-C-mFc Tag: C-mFc Domain: 24-197 aa of NM_000193 Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG Predict reactive species Full Name: sonic hedgehog homolog (Drosophila) Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: NM_000193 Gene Symbol: SHH Gene ID (NCBI): 6469 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15465 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.