Proteintech, 86129-1-RR, PUM1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PUM1 (86129-1-RR) by Proteintech is a Recombinant antibody targeting PUM1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86129-1-RR targets PUM1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, rat brain tissue, A549 cells, K-562 cells, HEK-293 cells, NIH/3T3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PUM1, also named as Pumilio homolog 1, is a 1186 amino acid protein, which is expressed in brain, heart, kidney, muscle, intestine and stomach. PUM1 as sequence-specific RNA-binding protein that acts as a post-transcriptional repressor by binding the 3'-UTR of mRNA targets. PUM1 binds to an RNA consensus sequence, the Pumilio Response Element (PRE), 5'-UGUANAUA-3', that is related to the Nanos Response Element (NRE). The calculated molecular weight of PUM1 is 126 kDa, but the modified PUM1 is about 130-140 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24651 Product name: Recombinant human PUM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC013398 Sequence: MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDEL Predict reactive species Full Name: pumilio homolog 1 (Drosophila) Calculated Molecular Weight: 1186 aa, 126 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC013398 Gene Symbol: PUM1 Gene ID (NCBI): 9698 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14671 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.