{"product_id":"proteintech-86157-3-rr","title":"Proteintech, 86157-3-RR, MYH10 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MYH10 (86157-3-RR) by Proteintech is a Recombinant antibody targeting MYH10 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n86157-3-RR targets MYH10 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293T cells,  mouse cerebellum tissue,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue,  rat cerebellum tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYH10 (non-muscle II-b, NM IIB) is a member of non-muscle myosin II which plays fundamental roles in the maintenance of cell morphology, cell adhesion, and migration, as well as cell division. MYH10 is mainly present in nerve cells, megakaryocytes, and other non-muscle cells. It has been reported to mediate centrosome reorientation during cell migration and contribute to ciliogenesis. Overexpression of MYH10 has been observed in breast cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag16113 Product name: Recombinant human MYH10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1183-1322 aa of BC150634 Sequence: QEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASL Predict reactive species\nFull Name: myosin, heavy chain 10, non-muscle\nCalculated Molecular Weight: 1985 aa, 230 kDa\nObserved Molecular Weight: 229 kDa\nGenBank Accession Number: BC150634\nGene Symbol: MYH10\nGene ID (NCBI): 4628\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P35580\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888787345577,"sku":"86157-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86157-3-rr","provider":"Iright","version":"1.0","type":"link"}