Proteintech, 86166-3-RR, PLEKHH2 Recombinant monoclonal antibody

Size: 20ul / 100ul The PLEKHH2 (86166-3-RR) by Proteintech is a Recombinant antibody targeting PLEKHH2 in WB, ELISA applications with reactivity to human samples 86166-3-RR targets PLEKHH2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information PLEKHH2 is a 1491-residue intracellular protein highly enriched in renal glomerular podocytes. PLEKHH2 is one of two previously uncharacterized PLEKHH proteins encoded in the mammalian genomes. A PLEKHH ortholog has also been described in Drosophila, Caenorhabditis elegans, and zebrafish. In C. elegans, the loss of the protein was found to cause variable axon guidance defects. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5409 Product name: Recombinant human PLEKHH2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-357 aa of BC063310 Sequence: MAELSEPEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAFQQVQVMEDKLKAANIQTSESETRLYNKCQDLESLIQEKDDVIQNLELQLEEQKQIRIQEAKIIEEKAAKIKEWVTVKLNELELENQNLRLINQNQTEEIRTMQSKLQEVQGKKSSTVSTLKLSEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISSKEPEFTEGKDMEEMEIPEKSVDNQVLENNRGQRTLHQTPCGSEQNRKTRTSFATDGGISQNSGAPVSDWSSDEEDGSKGRSKSRCTSTLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQE Predict reactive species Full Name: pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 Calculated Molecular Weight: 168 kDa Observed Molecular Weight: 168 kDa GenBank Accession Number: BC063310 Gene Symbol: PLEKHH2 Gene ID (NCBI): 130271 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IVE3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.