{"product_id":"proteintech-86192-3-rr","title":"Proteintech, 86192-3-RR, Myogenin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Myogenin (86192-3-RR) by Proteintech is a Recombinant antibody targeting Myogenin in WB, ELISA applications with reactivity to human, mouse, rat samples\n86192-3-RR targets Myogenin in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A-204 cells, C2C12 cells,  mouse heart tissue,  rat heart tissue,  mouse skeletal muscle tissue,  rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYOG (encoded Myogenin protein) is a muscle-specific transcription factor that belongs to a family of basic helix-loop-helix transcription factors. It plays a role in muscle differentiation, cell cycle exit, and muscle atrophy(PMID: 30315160). Diseases associated with MYOG include Embryonal Rhabdomyosarcoma and Gallbladder Sarcoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25081 Product name: Recombinant human Myogenin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-224 aa of BC053899 Sequence: SLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN Predict reactive species\nFull Name: myogenin (myogenic factor 4)\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC053899\nGene Symbol: Myogenin\nGene ID (NCBI): 4656\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P15173\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888787673257,"sku":"86192-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86192-3-rr","provider":"Iright","version":"1.0","type":"link"}