{"product_id":"proteintech-86205-2-rr","title":"Proteintech, 86205-2-RR, RPL13 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RPL13 (86205-2-RR) by Proteintech is a Recombinant antibody targeting RPL13 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, monkey samples\n86205-2-RR targets RPL13 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  K-562 cells,  MCF-7 cells,  COS-7 cells,  SGC-7091 cells,  NIH\/3T3 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mammalian ribosome comprises 79 ribosomal proteins and four rRNAs, which combine in equimolar ratios to form the small (40S) and large (60S) subunits. Ribosome proteins are a direct and critical target of the PI3K pathway in promoting growth.[PMID:15289434]. RPL13 may be a plausible candidate tumor suppressor gene, as knocking down L13 expression using small interfering RNA (siRNA) resulted in drastic attenuation of cancer cell growth with significant G1 and G2\/M arrest of the cell cycle[PMID:16786168].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1814 Product name: Recombinant human RPL13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC014167 Sequence: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKA Predict reactive species\nFull Name: ribosomal protein L13\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC014167\nGene Symbol: RPL13\nGene ID (NCBI): 6137\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P26373\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888816410793,"sku":"86205-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86205-2-rr","provider":"Iright","version":"1.0","type":"link"}