{"product_id":"proteintech-86218-2-rr","title":"Proteintech, 86218-2-RR, ATP5I Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ATP5I (86218-2-RR) by Proteintech is a Recombinant antibody targeting ATP5I in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n86218-2-RR targets ATP5I in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, U-251 cells,  A431 cells,  human heart tissue\nPositive IHC detected in: human colon tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP5I(ATP synthase subunit e) is also named as ATP5K and belongs to the  ATPase e subunit family. The ATP5I gene encodes the e subunit of the mitochondrial ATP synthase Fo complex. Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. Antisense ATP5I in a human HCC cell line inhibited cell growth suggesting that ATP5I acts through the MAP kinase pathway(PMID:11939412).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9605 Product name: Recombinant human ATP5I protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC003679 Sequence: MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK Predict reactive species\nFull Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E\nCalculated Molecular Weight: 69 aa, 8 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC003679\nGene Symbol: ATP5I\nGene ID (NCBI): 521\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P56385\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888709488809,"sku":"86218-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86218-2-rr","provider":"Iright","version":"1.0","type":"link"}