{"product_id":"proteintech-86229-1-rr","title":"Proteintech, 86229-1-RR, JAM-A\/CD321 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe JAM-A\/CD321 (86229-1-RR) by Proteintech is a Recombinant antibody targeting JAM-A\/CD321 in WB, IF\/ICC, ELISA applications with reactivity to mouse, rat samples\n86229-1-RR targets JAM-A\/CD321 in WB, IF\/ICC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: bEnd.3 cells, rat lung tissue,  mouse lung tissue,  mouse testis tissue,  mouse liver tissue\nPositive IF\/ICC detected in: bEnd.3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJunctional Adhesion Molecule-A (JAM-A), also known as CD321 or F11R, is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. It is primarily located in the tight junctions of epithelial and endothelial cells and is also expressed on circulating platelets and leukocytes (PMID: 34533648). Targeting F11R\/JAM-A with monoclonal antibodies or peptide antagonists has shown promise in inhibiting tumor growth and metastasis in mouse models (PMID: 37563645).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3117 Product name: Recombinant Mouse JAM-A\/Junctional Adhesion Molecule A protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-238 aa of NM_172647.2 Sequence: KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGG Predict reactive species\nFull Name: F11 receptor\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: NM_172647.2\nGene Symbol: F11r\nGene ID (NCBI): 16456\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O88792\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888645755049,"sku":"86229-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86229-1-rr","provider":"Iright","version":"1.0","type":"link"}