Proteintech, 86241-1-RR, PSMB8 Recombinant monoclonal antibody

Size: 20ul / 100ul The PSMB8 (86241-1-RR) by Proteintech is a Recombinant antibody targeting PSMB8 in WB, IF/ICC, ELISA applications with reactivity to human samples 86241-1-RR targets PSMB8 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HuT 78 cells, MOLT-4 cells, ACHN cells, Raji cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6660 Product name: Recombinant human PSMB8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC001114 Sequence: MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ Predict reactive species Full Name: proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 23 kDa, 30 kDa GenBank Accession Number: BC001114 Gene Symbol: PSMB8 Gene ID (NCBI): 5696 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P28062 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.