{"product_id":"proteintech-86245-1-rr","title":"Proteintech, 86245-1-RR, CYBRD1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CYBRD1 (86245-1-RR) by Proteintech is a Recombinant antibody targeting CYBRD1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86245-1-RR targets CYBRD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: T-47D cells, mouse colon tissue,  rat colon tissue,  COLO 320 cells,  SW480 cells,  HCT 116 cells,  NCI-H1299 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCYBRD1, also known as Cytochrome b Reductase 1, is a gene encoding a key enzyme involved in iron metabolism. It functions primarily in duodenal enterocytes, where it reduces dietary ferric iron (Fe³⁺) to the more soluble ferrous form (Fe²⁺) at the brush border membrane. This reduction step is crucial for the subsequent uptake of iron into the body via the divalent metal transporter 1 (DMT1). CYBRD1's activity is therefore essential for maintaining systemic iron homeostasis, and its expression is regulated by body iron stores and hypoxia. Dysregulation of this gene has been implicated in disorders of iron overload, such as hereditary hemochromatosis, highlighting its significant role in human iron physiology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24968 Product name: Recombinant human CYBRD1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 148-286 aa of BC065290 Sequence: PLSLRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM Predict reactive species\nFull Name: cytochrome b reductase 1\nObserved Molecular Weight: 25-31 kDa\nGenBank Accession Number: BC065290\nGene Symbol: CYBRD1\nGene ID (NCBI): 79901\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q53TN4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888731803817,"sku":"86245-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86245-1-rr","provider":"Iright","version":"1.0","type":"link"}