{"product_id":"proteintech-86252-1-rr","title":"Proteintech, 86252-1-RR, CD86 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD86 (86252-1-RR) by Proteintech is a Recombinant antibody targeting CD86 in WB, ELISA applications with reactivity to rat samples\n86252-1-RR targets CD86 in WB, ELISA applications and shows reactivity with rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat spleen tissue, rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD86 (also known as B7-2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and CTLA-4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response. (PMID: 7513726; 1847722; 11029388; 27591335)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3586 Product name: Recombinant Rat CD86 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-248 aa of NM_020081.1 Sequence: PVKRQAYFNSTAYLPCPFTKAQNISPSELVVFWQDRKKSVLYEHYLGAEKLDNVNAKYLGRTSFDRDNQALRLHNVQIKDTGLYDCFIQQKTPTGSIILQQWETELSVIANFSEPEIEEAQNETRNTGINLTCSSKQGYPKPTKMYFLITNSTNEYGDNMQISQDNVTKLFSVSISLSLPFPDGVYNMTIVCILETESMNISSKPHNMVFSQPQFDRKT Predict reactive species\nFull Name: CD86 molecule\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: NM_020081.1\nGene Symbol: Cd86\nGene ID (NCBI): 56822\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O35531\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888603975849,"sku":"86252-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86252-1-rr","provider":"Iright","version":"1.0","type":"link"}