Proteintech, 86258-5-RR, RTCB Recombinant monoclonal antibody

Size: 20ul / 100ul The RTCB (86258-5-RR) by Proteintech is a Recombinant antibody targeting RTCB in WB, ELISA applications with reactivity to human, mouse, rat samples 86258-5-RR targets RTCB in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, HEK-293T cells, HepG2 cells, 3T3-L1 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information RTCB (also known as HSPC117, C22orf28, FAAP and D10Wsu52e) is an essential subunit of a tRNA ligase complex that is involved in RNA repair and stress-induced splicing. As a multifunctional protein, RTCB is also a cell adhesion protein and is important in embryo and placenta development. Recently RTCB has been identified as UPR RNA ligase catalyzing unconventional XBP1 mRNA splicing. This antibody specifically recognizes endogenous RTCB protein. (25087875) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13836 Product name: Recombinant human C22orf28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 159-505 aa of BC000151 Sequence: GVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDFDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG Predict reactive species Full Name: chromosome 22 open reading frame 28 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC000151 Gene Symbol: RTCB Gene ID (NCBI): 51493 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y3I0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.