{"product_id":"proteintech-86274-1-rr","title":"Proteintech, 86274-1-RR, MCU\/CCDC109A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MCU\/CCDC109A (86274-1-RR) by Proteintech is a Recombinant antibody targeting MCU\/CCDC109A in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n86274-1-RR targets MCU\/CCDC109A in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  PANC-1 cells,  A549 cells,  NIH\/3T3 cells,  mouse skeletal muscle tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMCU, also known as CCDC109A, is highly conserved across all eukaryotes. The MCU protein is composed of two coiled-coil domains, two TMDs, and a short motif of amino acids between the two TMDs. Knockdown of MCU dramatically reduces mitochondrial Ca2+ uptake in isolated mitochondria, in permeabilized cells and living cells. MCU has 3 isoforms with MW 40,37 and 35 kDa (refer to UniProt). The observed MW of MCU is mainly between 30 to 35 kDa in paper (PMID: 26341627; 28337252).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24733 Product name: Recombinant human CCDC109A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 155-233 aa of BC034235 Sequence: DLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTT Predict reactive species\nFull Name: coiled-coil domain containing 109A\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC034235\nGene Symbol: CCDC109A\nGene ID (NCBI): 90550\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8NE86\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888649457833,"sku":"86274-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86274-1-rr","provider":"Iright","version":"1.0","type":"link"}