Proteintech, 86302-1-RR, RBM26 Recombinant monoclonal antibody

Size: 20ul / 100ul The RBM26 (86302-1-RR) by Proteintech is a Recombinant antibody targeting RBM26 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86302-1-RR targets RBM26 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, rat testis tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10398 Product name: Recombinant human RBM26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 751-1007 aa of BC000791 Sequence: TQKMLISKLEKNKTMKSEDKAEIMKTLEVLTKNITKLKDEVKAASPGRCLPKSIKTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTELQLEAAKRGILSSGRGRGIHSRGRGAVHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDREDLLPHFAQYGEIEDCQIDDSSLHAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKPVTNISAVETEEVEPDEEEFQEESLVDDSLLQDDDEEEEDNESRSWRR Predict reactive species Full Name: RNA binding motif protein 26 Calculated Molecular Weight: 983 aa, 111 kDa Observed Molecular Weight: 130-140 kDa GenBank Accession Number: BC000791 Gene Symbol: RBM26 Gene ID (NCBI): 64062 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5T8P6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.