{"product_id":"proteintech-86351-1-rr","title":"Proteintech, 86351-1-RR, WBSCR17 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe WBSCR17 (86351-1-RR) by Proteintech is a Recombinant antibody targeting WBSCR17 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86351-1-RR targets WBSCR17 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWBSCR17, also known as GALNT17, which encodes a brain-expressed N-acetylgalactosaminyl transferase (GalNAcT), is located at the distal edge of a region that is commonly deleted or duplicated in Williams Beuren Syndrome (WBS), a developmental disorder with motor and coordination problems, impaired visuospatial memory, and abnormal social interaction (PMID: 31554716). WBSCR17 loss-of-function has significant effects on cerebellar development, and is associated with phenotypes including developmental delay, deficits in motor coordination, reduced exploratory activity, and impaired social behavior (PMID: 22787146). With the calculated molecular mass of recombinant WBSCR17 being 68 kDa, the 70-90-kDa glycoproteins could also be detected due to post-translational modifications (PMID: 22787146).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag15792 Product name: Recombinant human WBSCR17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC069624 Sequence: MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE Predict reactive species\nFull Name: Williams-Beuren syndrome chromosome region 17\nCalculated Molecular Weight: 598 aa, 68 kDa\nObserved Molecular Weight: 70~90 kDa\nGenBank Accession Number: BC069624\nGene Symbol: WBSCR17\nGene ID (NCBI): 64409\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6IS24\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888841871529,"sku":"86351-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86351-1-rr","provider":"Iright","version":"1.0","type":"link"}