{"product_id":"proteintech-86358-1-rr","title":"Proteintech, 86358-1-RR, MSRA Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MSRA (86358-1-RR) by Proteintech is a Recombinant antibody targeting MSRA in WB, IF\/ICC, ELISA applications with reactivity to human, rat samples\n86358-1-RR targets MSRA in WB, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, HT-1080 cells,  rat kidney tissue\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMethionine sulfoxide reductase A (MSRA) is an antioxidant enzyme found in all domains of life that catalyzes the reduction of methionine-S-sulfoxide (MSO) to methionine in proteins and free amino acids (PMID: 28874471). MSRA has some isoforms with MW of 19~26 kDa. MSRA functions in the repair of oxidatively damaged proteins to restore biological activity. Transfection of MSRA reduced colony formation and the invasiveness of HCC cell lines. Studies have demonstrated the downregulation of MSRA in multiple human tumors, including breast cancers and its levels have been linked to advanced tumor grades (PMID: 20937881).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6053 Product name: Recombinant human MSRA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of BC054033 Sequence: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK Predict reactive species\nFull Name: methionine sulfoxide reductase A\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 24-26 kDa\nGenBank Accession Number: BC054033\nGene Symbol: MSRA\nGene ID (NCBI): 4482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UJ68\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888786002089,"sku":"86358-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86358-1-rr","provider":"Iright","version":"1.0","type":"link"}