{"product_id":"proteintech-86362-2-rr","title":"Proteintech, 86362-2-RR, HLTF Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HLTF (86362-2-RR) by Proteintech is a Recombinant antibody targeting HLTF in WB, ELISA applications with reactivity to human, mouse, monkey samples\n86362-2-RR targets HLTF in WB, ELISA applications and shows reactivity with human, mouse, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells, HeLa cells,  K-562 cells,  HCT 116 cells,  COS-7 cells,  NIH\/\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHelicase-like Transcription Factor (HLTF) is a crucial nuclear protein and member of the SWI\/SNF family of chromatin-remodeling complexes, playing a dual role in transcription regulation and DNA damage repair. It functions dually as a regulator of gene expression, utilizing its ATP-dependent helicase activity to modify chromatin structure and facilitate transcription, and as a central effector in the DNA damage response pathway. HLTF is particularly crucial for promoting error-free DNA repair at stalled replication forks via a mechanism called template switching, which prevents the accumulation of mutagenic lesions. HLTF can be detected as 114 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5596 Product name: Recombinant human HLTF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC044659 Sequence: MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKEYNVNDDSMKLGGNNTSEKADGLS Predict reactive species\nFull Name: helicase-like transcription factor\nCalculated Molecular Weight: 114 kDa\nObserved Molecular Weight: 114 kDa\nGenBank Accession Number: BC044659\nGene Symbol: HLTF\nGene ID (NCBI): 6596\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14527\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888761884841,"sku":"86362-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-86362-2-rr","provider":"Iright","version":"1.0","type":"link"}